Lineage for d6cq1a_ (6cq1 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [102923] (34 PDB entries)
  8. Domain d6cq1a_: 6cq1 A: [366375]
    automated match to d1r2ba_
    complexed with f8j

Details for d6cq1a_

PDB Entry: 6cq1 (more details), 1.7000000000000002 Å

PDB Description: bcl6 btb domain in complex with 15a
PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d6cq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cq1a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
dsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdql
krnlsvinldpeinpegfnilldfmytsrlnlrvgnimavmatamylqmehvvdtcrkfi
kas

SCOPe Domain Coordinates for d6cq1a_ are not available.

Timeline for d6cq1a_:

Domains from other chains:
(mouse over for more information)
d6cq1b_