Lineage for d6coea_ (6coe A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. Protein automated matches [190543] (128 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries)
  8. Domain d6coea_: 6coe A: [366361]
    Other proteins in same PDB: d6coeb2
    automated match to d3dqza_
    complexed with cl, gol, hbx, mnn, mxn; mutant

Details for d6coea_

PDB Entry: 6coe (more details), 1.84 Å

PDB Description: athnl enantioselectivity mutant at-a9-h7 apo y13c,y121l,p126f,l128w, c131t,f179l,a209i with benzaldehyde, mandelic acid nitrile
PDB Compounds: (A:) Alpha-hydroxynitrile lyase

SCOPe Domain Sequences for d6coea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6coea_ c.69.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
merkhhfvlvhnachgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
klmemfggwgdtefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgslf
tedlskkekfseegygsvqrvyvmssedkiipcdfirwmidnfnvskvyeidggdhmvml
skpqklfdslsaiatdym

SCOPe Domain Coordinates for d6coea_ are not available.

Timeline for d6coea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6coeb1, d6coeb2