![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.2: RNase P protein [54220] (2 proteins) automatically mapped to Pfam PF00825 |
![]() | Protein automated matches [357987] (2 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:243274] [366347] (2 PDB entries) |
![]() | Domain d6cqcd_: 6cqc D: [366357] automated match to d1nz0c_ protein/RNA complex; complexed with 8p4, so4 |
PDB Entry: 6cqc (more details), 1.54 Å
SCOPe Domain Sequences for d6cqcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cqcd_ d.14.1.2 (D:) automated matches {Thermotoga maritima [TaxId: 243274]} rlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatrrnklkrwvre ifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrie
Timeline for d6cqcd_: