![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins) forms homohexameric ring structures |
![]() | Protein Pleiotropic translational regulator Hfq [74940] (3 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [141293] (12 PDB entries) Uniprot Q9HUM0 6-71 |
![]() | Domain d6o1kk_: 6o1k K: [366323] Other proteins in same PDB: d6o1ka1, d6o1ka2, d6o1kb1, d6o1kb2 automated match to d3quia_ protein/RNA complex |
PDB Entry: 6o1k (more details), 3.13 Å
SCOPe Domain Sequences for d6o1kk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o1kk_ b.38.1.2 (K:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp srpvr
Timeline for d6o1kk_: