SCOPe 2.07: Domain d5zhea_: 5zhe A:

Lineage for d5zhea_ (5zhe A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein Undecaprenyl diphosphate synthase [64007] (3 species)

7. Species Escherichia coli [TaxId:562] [64009] (17 PDB entries)

8. Domain d5zhea_: 5zhe A: [366319]
   automated match to d1ueha_
   complexed with hjx

Details for d5zhea_

PDB Entry: 5zhe, 2.18 Å

PDB Description: structure of e. coli undecaprenyl diphosphate synthase in complex with bph-981

PDB Compounds: (A:) Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

SCOPe Domain Sequences for d5zhea_:

Sequence, based on SEQRES records:

>d5zhea_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsse
nwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtag
ntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvi
rtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr

Sequence, based on observed residues (ATOM records):

>d5zhea_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsal
dsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivq
gvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayae
lyftdvlwpdfdeqdfegalnafanr

Timeline for d5zhea_:

• d5zhea_ is new in SCOPe 2.07-stable
  
• d5zhea_ appears in the current release, SCOPe 2.08