Lineage for d5zhea_ (5zhe A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919043Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2919044Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2919045Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 2919046Protein Undecaprenyl diphosphate synthase [64007] (3 species)
  7. 2919050Species Escherichia coli [TaxId:562] [64009] (17 PDB entries)
  8. 2919083Domain d5zhea_: 5zhe A: [366319]
    automated match to d1ueha_
    complexed with hjx

Details for d5zhea_

PDB Entry: 5zhe (more details), 2.18 Å

PDB Description: structure of e. coli undecaprenyl diphosphate synthase in complex with bph-981
PDB Compounds: (A:) Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

SCOPe Domain Sequences for d5zhea_:

Sequence, based on SEQRES records: (download)

>d5zhea_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsse
nwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtag
ntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvi
rtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr

Sequence, based on observed residues (ATOM records): (download)

>d5zhea_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsal
dsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivq
gvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayae
lyftdvlwpdfdeqdfegalnafanr

SCOPe Domain Coordinates for d5zhea_:

Click to download the PDB-style file with coordinates for d5zhea_.
(The format of our PDB-style files is described here.)

Timeline for d5zhea_: