Lineage for d6i07b2 (6i07 B:128-242)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757521Domain d6i07b2: 6i07 B:128-242 [366296]
    automated match to d4r8wl_
    complexed with gol

Details for d6i07b2

PDB Entry: 6i07 (more details), 2.35 Å

PDB Description: crystal structure of epcam in complex with scfv
PDB Compounds: (B:) single chain fv

SCOPe Domain Sequences for d6i07b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i07b2 b.1.1.0 (B:128-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgesvkisckasgytftnygmnwvrqqpgqclkwmgwintytgesty
addfkgrfafsldtsastaylqlsslrsedtavyfcarfaikgdywgqgtlvtvs

SCOPe Domain Coordinates for d6i07b2:

Click to download the PDB-style file with coordinates for d6i07b2.
(The format of our PDB-style files is described here.)

Timeline for d6i07b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6i07b1