Lineage for d6o1kn_ (6o1k N:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787114Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2787115Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 2787123Species Pseudomonas aeruginosa [TaxId:287] [141293] (12 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 2787208Domain d6o1kn_: 6o1k N: [366294]
    Other proteins in same PDB: d6o1ka1, d6o1ka2, d6o1kb1, d6o1kb2
    automated match to d3quia_
    protein/RNA complex

Details for d6o1kn_

PDB Entry: 6o1k (more details), 3.13 Å

PDB Description: architectural principles for hfq/crc-mediated regulation of gene expression. hfq-crc-amie 2:2:2 complex (core complex)
PDB Compounds: (N:) RNA-binding protein Hfq

SCOPe Domain Sequences for d6o1kn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o1kn_ b.38.1.2 (N:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
srpvrl

SCOPe Domain Coordinates for d6o1kn_:

Click to download the PDB-style file with coordinates for d6o1kn_.
(The format of our PDB-style files is described here.)

Timeline for d6o1kn_: