Lineage for d6o55a_ (6o55 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857183Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2857184Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
    automatically mapped to Pfam PF00731
  6. 2857234Protein automated matches [191111] (4 species)
    not a true protein
  7. 2857289Species Legionella pneumophila [TaxId:272624] [366278] (1 PDB entry)
  8. 2857290Domain d6o55a_: 6o55 A: [366281]
    automated match to d3kuud_
    complexed with cl, edo, pg4

Details for d6o55a_

PDB Entry: 6o55 (more details), 1.7 Å

PDB Description: crystal structure of n5-carboxyaminoimidazole ribonucleotide mutase (pure) from legionella pneumophila
PDB Compounds: (A:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d6o55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o55a_ c.23.8.1 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
kpiliglimgsqsdwqtlihaahtldalnigyeaeivsahrtpdklfryaeqaearglev
iiagaggaahlpgmvaaktslpvlgvpvmsqtlngvdsllsivqmpagipvgtlsigkag
ainsalfaaailankypdiraalkhyreqqtqkvldnpnpk

SCOPe Domain Coordinates for d6o55a_:

Click to download the PDB-style file with coordinates for d6o55a_.
(The format of our PDB-style files is described here.)

Timeline for d6o55a_: