Lineage for d6o1ka1 (6o1k A:1-259)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988254Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2988255Protein automated matches [190734] (14 species)
    not a true protein
  7. 2988294Species Pseudomonas aeruginosa [TaxId:287] [226583] (3 PDB entries)
  8. 2988297Domain d6o1ka1: 6o1k A:1-259 [366232]
    Other proteins in same PDB: d6o1ka2, d6o1kb2, d6o1kc_, d6o1kd_, d6o1ke_, d6o1kf_, d6o1kg_, d6o1kh_, d6o1ki_, d6o1kj_, d6o1kk_, d6o1kl_, d6o1km_, d6o1kn_
    automated match to d2myia_
    protein/RNA complex

Details for d6o1ka1

PDB Entry: 6o1k (more details), 3.13 Å

PDB Description: architectural principles for hfq/crc-mediated regulation of gene expression. hfq-crc-amie 2:2:2 complex (core complex)
PDB Compounds: (A:) Catabolite repression control protein

SCOPe Domain Sequences for d6o1ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o1ka1 d.151.1.0 (A:1-259) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflyacda
elpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgdesln
qkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperawlde
vfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnaklprq
prfsqhaplivdydwqlsi

SCOPe Domain Coordinates for d6o1ka1:

Click to download the PDB-style file with coordinates for d6o1ka1.
(The format of our PDB-style files is described here.)

Timeline for d6o1ka1: