![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
![]() | Protein automated matches [190734] (14 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [226583] (3 PDB entries) |
![]() | Domain d6o1kb1: 6o1k B:1-259 [366225] Other proteins in same PDB: d6o1ka2, d6o1kb2, d6o1kc_, d6o1kd_, d6o1ke_, d6o1kf_, d6o1kg_, d6o1kh_, d6o1ki_, d6o1kj_, d6o1kk_, d6o1kl_, d6o1km_, d6o1kn_ automated match to d2myia_ protein/RNA complex |
PDB Entry: 6o1k (more details), 3.13 Å
SCOPe Domain Sequences for d6o1kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o1kb1 d.151.1.0 (B:1-259) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mriisvnvngiqaaaergllswlqaqnadviclqdtrasafdlddpsfqldgyflyacda elpeqggvalysrlqpkavisglgfetadrygrylqadfdkvsiatlllpsgqsgdesln qkfkfmddfthylskqrrkrreyiycgslyvahqkmdvknwrecqqmpgflaperawlde vfgnlgyadalrevsregdqfswwpdseqaemlnlgwrfdyqvltpglrrfvrnaklprq prfsqhaplivdydwqlsi
Timeline for d6o1kb1: