| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) ![]() automatically mapped to Pfam PF02936 |
| Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81403] (28 PDB entries) |
| Domain d6nmpd_: 6nmp D: [366213] Other proteins in same PDB: d6nmpa_, d6nmpb1, d6nmpb2, d6nmpc_, d6nmpe_, d6nmpf_, d6nmpg_, d6nmph_, d6nmpi_, d6nmpj_, d6nmpk_, d6nmpl_, d6nmpm_, d6nmpn_, d6nmpo1, d6nmpo2, d6nmpp_, d6nmpr_, d6nmps_, d6nmpt_, d6nmpu_, d6nmpv_, d6nmpw_, d6nmpx_, d6nmpy_, d6nmpz_ automated match to d1v54d_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 6nmp (more details), 2.9 Å
SCOPe Domain Sequences for d6nmpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmpd_ f.23.1.1 (D:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk
Timeline for d6nmpd_:
View in 3DDomains from other chains: (mouse over for more information) d6nmpa_, d6nmpb1, d6nmpb2, d6nmpc_, d6nmpe_, d6nmpf_, d6nmpg_, d6nmph_, d6nmpi_, d6nmpj_, d6nmpk_, d6nmpl_, d6nmpm_, d6nmpn_, d6nmpo1, d6nmpo2, d6nmpp_, d6nmpq_, d6nmpr_, d6nmps_, d6nmpt_, d6nmpu_, d6nmpv_, d6nmpw_, d6nmpx_, d6nmpy_, d6nmpz_ |