Lineage for d1hfzd_ (1hfz D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2495039Family d.2.1.2: C-type lysozyme [53960] (3 protein domains)
    automatically mapped to Pfam PF00062
  6. 2495040Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 2495041Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries)
  8. 2495057Domain d1hfzd_: 1hfz D: [36621]
    complexed with ca

Details for d1hfzd_

PDB Entry: 1hfz (more details), 2.3 Å

PDB Description: alpha-lactalbumin
PDB Compounds: (D:) alpha-lactalbumin

SCOPe Domain Sequences for d1hfzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfzd_ d.2.1.2 (D:) alpha-Lactalbumin {Cow (Bos taurus) [TaxId: 9913]}
meqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnki
wckddqnphssnicniscdkfldddltddivcvkkildkvginywlahkalcsekldqwl
cekl

SCOPe Domain Coordinates for d1hfzd_:

Click to download the PDB-style file with coordinates for d1hfzd_.
(The format of our PDB-style files is described here.)

Timeline for d1hfzd_: