Lineage for d1hfzc_ (1hfz C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323287Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 323288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 323297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 323298Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 323301Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries)
  8. 323316Domain d1hfzc_: 1hfz C: [36620]

Details for d1hfzc_

PDB Entry: 1hfz (more details), 2.3 Å

PDB Description: alpha-lactalbumin

SCOP Domain Sequences for d1hfzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfzc_ d.2.1.2 (C:) alpha-Lactalbumin {Cow (Bos taurus)}
meqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnki
wckddqnphssnicniscdkfldddltddivcvkkildkvginywlahkalcsekldqwl
ce

SCOP Domain Coordinates for d1hfzc_:

Click to download the PDB-style file with coordinates for d1hfzc_.
(The format of our PDB-style files is described here.)

Timeline for d1hfzc_: