Lineage for d1hfzb_ (1hfz B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) 
Protein alpha-Lactalbumin [53975] (5 species) 
Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries) 
Domain d1hfzb_: 1hfz B: [36619]
Details for d1hfzb_
PDB Entry: 1hfz (more details), 2.3 Å
PDB Description: alpha-lactalbumin
SCOP Domain Sequences for d1hfzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfzb_ d.2.1.2 (B:) alpha-Lactalbumin {Cow (Bos taurus)}
meqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnki
wckddqnphssnicniscdkfldddltddivcvkkildkvginywlahkalcsekldqwl
ce
SCOP Domain Coordinates for d1hfzb_:
Click to download the PDB-style file with coordinates for d1hfzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hfzb_:
- d1hfzb_ appears in SCOP 1.57
- d1hfzb_ appears in the current release, SCOPe 2.08
View in 3D
