SCOPe 2.08: Domain d6nmfv_: 6nmf V:

Lineage for d6nmfv_ (6nmf V:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)
   automatically mapped to Pfam PF02937

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries)

8. Domain d6nmfv_: 6nmf V: [366181]
   Other proteins in same PDB: d6nmfa_, d6nmfb1, d6nmfb2, d6nmfc_, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfh_, d6nmfj_, d6nmfk_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfo1, d6nmfo2, d6nmfp_, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfu_, d6nmfw_, d6nmfx_, d6nmfy_, d6nmfz_
   automated match to d1v54i_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d6nmfv_

PDB Entry: 6nmf, 2.8 Å

PDB Description: sfx structure of reduced cytochrome c oxidase at room temperature

PDB Compounds: (V:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d6nmfv_:

Sequence; same for both SEQRES and ATOM records:

>d6nmfv_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

Timeline for d6nmfv_:

• d6nmfv_ first appeared in SCOPe 2.07