SCOPe 2.07: Domain d6nmfb2: 6nmf B:91-227

Lineage for d6nmfb2 (6nmf B:91-227)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries)

8. Domain d6nmfb2: 6nmf B:91-227 [366179]
   Other proteins in same PDB: d6nmfa_, d6nmfb1, d6nmfc_, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfh_, d6nmfi_, d6nmfj_, d6nmfk_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfo1, d6nmfp_, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfu_, d6nmfv_, d6nmfw_, d6nmfx_, d6nmfy_, d6nmfz_
   automated match to d1v54b1
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d6nmfb2

PDB Entry: 6nmf, 2.8 Å

PDB Description: sfx structure of reduced cytochrome c oxidase at room temperature

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6nmfb2:

Sequence; same for both SEQRES and ATOM records:

>d6nmfb2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d6nmfb2:

• d6nmfb2 is new in SCOPe 2.07-stable
  
• d6nmfb2 appears in the current release, SCOPe 2.08