Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) |
Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries) |
Domain d1f6sa_: 1f6s A: [36612] complexed with ca |
PDB Entry: 1f6s (more details), 2.2 Å
SCOPe Domain Sequences for d1f6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6sa_ d.2.1.2 (A:) alpha-Lactalbumin {Cow (Bos taurus) [TaxId: 9913]} eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc ek
Timeline for d1f6sa_: