![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
![]() | Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries) |
![]() | Domain d1f6re_: 1f6r E: [36610] |
PDB Entry: 1f6r (more details), 2.2 Å
SCOP Domain Sequences for d1f6re_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6re_ d.2.1.2 (E:) alpha-Lactalbumin {Cow (Bos taurus)} eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc e
Timeline for d1f6re_: