SCOPe 2.06: Domain d1f6rc_: 1f6r C:

Lineage for d1f6rc_ (1f6r C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries)

8. Domain d1f6rc_: 1f6r C: [36608]

Details for d1f6rc_

PDB Entry: 1f6r, 2.2 Å

PDB Description: crystal structure of apo-bovine alpha-lactalbumin

PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1f6rc_:

Sequence; same for both SEQRES and ATOM records:

>d1f6rc_ d.2.1.2 (C:) alpha-Lactalbumin {Cow (Bos taurus) [TaxId: 9913]}
eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc
e

Timeline for d1f6rc_:

• d1f6rc_ first appeared (with stable ids) in SCOP 1.55
  
• d1f6rc_ appears in SCOPe 2.05
  
• d1f6rc_ appears in SCOPe 2.07
  
• d1f6rc_ appears in the current release, SCOPe 2.08