Lineage for d1f6rc_ (1f6r C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2495039Family d.2.1.2: C-type lysozyme [53960] (3 protein domains)
    automatically mapped to Pfam PF00062
  6. 2495040Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 2495041Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries)
  8. 2495044Domain d1f6rc_: 1f6r C: [36608]

Details for d1f6rc_

PDB Entry: 1f6r (more details), 2.2 Å

PDB Description: crystal structure of apo-bovine alpha-lactalbumin
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d1f6rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6rc_ d.2.1.2 (C:) alpha-Lactalbumin {Cow (Bos taurus) [TaxId: 9913]}
eqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphssnicniscdkfldddltddimcvkkildkvginywlahkalcsekldqwlc
e

SCOPe Domain Coordinates for d1f6rc_:

Click to download the PDB-style file with coordinates for d1f6rc_.
(The format of our PDB-style files is described here.)

Timeline for d1f6rc_: