SCOPe 2.08: Domain d6hy3a1: 6hy3 A:69-328

Lineage for d6hy3a1 (6hy3 A:69-328)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Zobellia galactanivorans [TaxId:63186] [224860] (7 PDB entries)

8. Domain d6hy3a1: 6hy3 A:69-328 [366050]
   Other proteins in same PDB: d6hy3a2
   automated match to d3wz1a_
   complexed with edo, gol, mg

Details for d6hy3a1

PDB Entry: 6hy3, 1.3 Å

PDB Description: three-dimensional structure of agac from zobellia galactanivorans

PDB Compounds: (A:) Beta-agarase C

SCOPe Domain Sequences for d6hy3a1:

Sequence; same for both SEQRES and ATOM records:

>d6hy3a1 b.29.1.0 (A:69-328) automated matches {Zobellia galactanivorans [TaxId: 63186]}
tydftgntpppapqgmkwvkisqlsdefnngfntdkwtkslwnygvpvqmkaensgvsdg
klwikatlgndperwfetsrvmskaqvnypmytvsrikgahisayntfwlnngnisnrne
idviennsnpscncqpdfpwqmnsqyfhvvnddtkrnkgnfdnrelsdanplkgvawnee
yhtfgvwwkdathiqfyldgepagsvvsardftrelniiwdlwtvdadwlgglakkehls
nnnintmkidwihtyqlvee

Timeline for d6hy3a1:

• d6hy3a1 first appeared in SCOPe 2.07