Lineage for d6hy3a1 (6hy3 A:69-328)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375739Species Zobellia galactanivorans [TaxId:63186] [224860] (7 PDB entries)
  8. 3065988Domain d6hy3a1: 6hy3 A:69-328 [366050]
    Other proteins in same PDB: d6hy3a2
    automated match to d3wz1a_
    complexed with edo, gol, mg

Details for d6hy3a1

PDB Entry: 6hy3 (more details), 1.3 Å

PDB Description: three-dimensional structure of agac from zobellia galactanivorans
PDB Compounds: (A:) Beta-agarase C

SCOPe Domain Sequences for d6hy3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hy3a1 b.29.1.0 (A:69-328) automated matches {Zobellia galactanivorans [TaxId: 63186]}
tydftgntpppapqgmkwvkisqlsdefnngfntdkwtkslwnygvpvqmkaensgvsdg
klwikatlgndperwfetsrvmskaqvnypmytvsrikgahisayntfwlnngnisnrne
idviennsnpscncqpdfpwqmnsqyfhvvnddtkrnkgnfdnrelsdanplkgvawnee
yhtfgvwwkdathiqfyldgepagsvvsardftrelniiwdlwtvdadwlgglakkehls
nnnintmkidwihtyqlvee

SCOPe Domain Coordinates for d6hy3a1:

Click to download the PDB-style file with coordinates for d6hy3a1.
(The format of our PDB-style files is described here.)

Timeline for d6hy3a1:

  • d6hy3a1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6hy3a2