Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.40: Pre-mRNA splicing factor Prp19 coiled coil domain [345934] (2 families) Pfam PF08606 |
Family h.1.40.0: automated matches [365885] (1 protein) not a true family |
Protein automated matches [365886] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [365887] (3 PDB entries) |
Domain d6id1r2: 6id1 r:60-133 [366045] Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1r1, d6id1s_, d6id1t_, d6id1y_ automated match to d3jb9s2 complexed with gtp, i6p, mg, zn |
PDB Entry: 6id1 (more details), 2.86 Å
SCOPe Domain Sequences for d6id1r2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id1r2 h.1.40.0 (r:60-133) automated matches {Homo sapiens [TaxId: 9606]} pirpkppsatsipailkalqdewdavmlhsftlrqqlqttrqelshalyqhdaacrviar ltkevtaarealat
Timeline for d6id1r2: