Lineage for d1hfya_ (1hfy A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 497065Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 497066Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 497075Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 497076Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 497096Species Goat (Capra hircus) [TaxId:9925] [53979] (4 PDB entries)
  8. 497100Domain d1hfya_: 1hfy A: [36604]

Details for d1hfya_

PDB Entry: 1hfy (more details), 2.3 Å

PDB Description: alpha-lactalbumin

SCOP Domain Sequences for d1hfya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfya_ d.2.1.2 (A:) alpha-Lactalbumin {Goat (Capra hircus)}
eqltkcevfqklkdlkdyggvslpewvctafhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwlc

SCOP Domain Coordinates for d1hfya_:

Click to download the PDB-style file with coordinates for d1hfya_.
(The format of our PDB-style files is described here.)

Timeline for d1hfya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hfyb_