Lineage for d6jcjc1 (6jcj C:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2471550Species Chicken (Gallus gallus) [TaxId:9031] [278810] (20 PDB entries)
  8. 2471568Domain d6jcjc1: 6jcj C:1-245 [366030]
    Other proteins in same PDB: d6jcja2, d6jcjb2, d6jcjc2, d6jcjd2, d6jcje_, d6jcjf1, d6jcjf2
    automated match to d5fnva1
    complexed with acp, bg0, ca, gdp, gtp, mg

Details for d6jcjc1

PDB Entry: 6jcj (more details), 2.5 Å

PDB Description: structure of crolibulin in complex with tubulin
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6jcjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jcjc1 c.32.1.1 (C:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d6jcjc1:

Click to download the PDB-style file with coordinates for d6jcjc1.
(The format of our PDB-style files is described here.)

Timeline for d6jcjc1: