Lineage for d1hmka_ (1hmk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1887055Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1887056Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 1887074Species Goat (Capra hircus) [TaxId:9925] [53979] (5 PDB entries)
  8. 1887079Domain d1hmka_: 1hmk A: [36603]
    complexed with ca

Details for d1hmka_

PDB Entry: 1hmk (more details), 2 Å

PDB Description: recombinant goat alpha-lactalbumin
PDB Compounds: (A:) protein (alpha-lactalbumin)

SCOPe Domain Sequences for d1hmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmka_ d.2.1.2 (A:) alpha-Lactalbumin {Goat (Capra hircus) [TaxId: 9925]}
meqltkcevfqklkdlkdyggvslpewvctafhtsgydtqaivqnndsteyglfqinnki
wckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwl
c

SCOPe Domain Coordinates for d1hmka_:

Click to download the PDB-style file with coordinates for d1hmka_.
(The format of our PDB-style files is described here.)

Timeline for d1hmka_: