Lineage for d1hmka_ (1hmk A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) 
Protein alpha-Lactalbumin [53975] (5 species) 
Species Goat (Capra hircus) [TaxId:9925] [53979] (4 PDB entries) 
Domain d1hmka_: 1hmk A: [36603]
Details for d1hmka_
PDB Entry: 1hmk (more details), 2 Å
PDB Description: recombinant goat alpha-lactalbumin
SCOP Domain Sequences for d1hmka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hmka_ d.2.1.2 (A:) alpha-Lactalbumin {Goat (Capra hircus)}
meqltkcevfqklkdlkdyggvslpewvctafhtsgydtqaivqnndsteyglfqinnki
wckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwl
c
SCOP Domain Coordinates for d1hmka_:
Click to download the PDB-style file with coordinates for d1hmka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hmka_:
- d1hmka_ appears in SCOP 1.57
- d1hmka_ appears in the current release, SCOPe 2.08
View in 3D