Lineage for d6jcjb2 (6jcj B:244-428)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525736Species Sheep (Ovis aries) [TaxId:9940] [226224] (19 PDB entries)
  8. 3065966Domain d6jcjb2: 6jcj B:244-428 [366028]
    Other proteins in same PDB: d6jcja1, d6jcjb1, d6jcjc1, d6jcjd1, d6jcje_, d6jcjf1, d6jcjf2
    automated match to d3rycd2
    complexed with acp, bg0, ca, gdp, gtp, mg

Details for d6jcjb2

PDB Entry: 6jcj (more details), 2.5 Å

PDB Description: structure of crolibulin in complex with tubulin
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6jcjb2:

Sequence, based on SEQRES records: (download)

>d6jcjb2 d.79.2.1 (B:244-428) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d6jcjb2 d.79.2.1 (B:244-428) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh
gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
a

SCOPe Domain Coordinates for d6jcjb2:

Click to download the PDB-style file with coordinates for d6jcjb2.
(The format of our PDB-style files is described here.)

Timeline for d6jcjb2:

  • d6jcjb2 appears in periodic updates to SCOPe 2.07 starting on 2019-03-16