Lineage for d6jcjb1 (6jcj B:1-243)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445493Species Sheep (Ovis aries) [TaxId:9940] [224884] (19 PDB entries)
  8. 3065965Domain d6jcjb1: 6jcj B:1-243 [366027]
    Other proteins in same PDB: d6jcja2, d6jcjb2, d6jcjc2, d6jcjd2, d6jcje_, d6jcjf1, d6jcjf2
    automated match to d4drxb1
    complexed with acp, bg0, ca, gdp, gtp, mg

Details for d6jcjb1

PDB Entry: 6jcj (more details), 2.5 Å

PDB Description: structure of crolibulin in complex with tubulin
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6jcjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jcjb1 c.32.1.1 (B:1-243) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d6jcjb1:

Click to download the PDB-style file with coordinates for d6jcjb1.
(The format of our PDB-style files is described here.)

Timeline for d6jcjb1:

  • d6jcjb1 appears in periodic updates to SCOPe 2.07 starting on 2019-03-16