Lineage for d6ikkc_ (6ikk C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2567239Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2567265Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2567266Protein automated matches [195455] (13 species)
    not a true protein
  7. 2567340Species Pseudomonas aeruginosa [TaxId:208964] [316357] (11 PDB entries)
  8. 2567358Domain d6ikkc_: 6ikk C: [366021]
    automated match to d4zhva_
    complexed with so4

Details for d6ikkc_

PDB Entry: 6ikk (more details), 2.19 Å

PDB Description: crystal structure of yfib(l43p) in complex with yfir
PDB Compounds: (C:) YfiB

SCOPe Domain Sequences for d6ikkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ikkc_ d.79.7.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
pqeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdidkvrleghtd
nygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktragrsenrrva
iivpa

SCOPe Domain Coordinates for d6ikkc_:

Click to download the PDB-style file with coordinates for d6ikkc_.
(The format of our PDB-style files is described here.)

Timeline for d6ikkc_: