SCOPe 2.08: Domain d6ikkc_: 6ikk C:

Lineage for d6ikkc_ (6ikk C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (14 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [316357] (11 PDB entries)

8. Domain d6ikkc_: 6ikk C: [366021]
   automated match to d4zhva_
   complexed with so4

Details for d6ikkc_

PDB Entry: 6ikk, 2.19 Å

PDB Description: crystal structure of yfib(l43p) in complex with yfir

PDB Compounds: (C:) YfiB

SCOPe Domain Sequences for d6ikkc_:

Sequence; same for both SEQRES and ATOM records:

>d6ikkc_ d.79.7.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
pqeqgfelrdegwefgmsskvlfgnnldrlnpdsrntltkiarallavdidkvrleghtd
nygdegynqklserraesvaavfreagmpaanievrglgmskpvadnktragrsenrrva
iivpa

Timeline for d6ikkc_:

• d6ikkc_ first appeared in SCOPe 2.07