SCOP 1.67: Domain d1fkqa_: 1fkq A:

Lineage for d1fkqa_ (1fkq A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Goat (Capra hircus) [TaxId:9925] [53979] (4 PDB entries)

8. Domain d1fkqa_: 1fkq A: [36601]
   complexed with ca; mutant

Details for d1fkqa_

PDB Entry: 1fkq, 1.8 Å

PDB Description: recombinant goat alpha-lactalbumin t29v

SCOP Domain Sequences for d1fkqa_:

Sequence; same for both SEQRES and ATOM records:

>d1fkqa_ d.2.1.2 (A:) alpha-Lactalbumin {Goat (Capra hircus)}
meqltkcevfqklkdlkdyggvslpewvcvafhtsgydtqaivqnndsteyglfqinnki
wckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwl
cekl

Timeline for d1fkqa_:

• d1fkqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fkqa_ appears in SCOP 1.65
  
• d1fkqa_ appears in SCOP 1.69
  
• d1fkqa_ appears in the current release, SCOPe 2.08, called d1fkqa1