Lineage for d1fkqa_ (1fkq A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28770Protein alpha-Lactalbumin [53975] (5 species)
  7. 28790Species Goat (Capra hircus) [TaxId:9925] [53979] (4 PDB entries)
  8. 28791Domain d1fkqa_: 1fkq A: [36601]

Details for d1fkqa_

PDB Entry: 1fkq (more details), 1.8 Å

PDB Description: recombinant goat alpha-lactalbumin t29v

SCOP Domain Sequences for d1fkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkqa_ d.2.1.2 (A:) alpha-Lactalbumin {Goat (Capra hircus)}
meqltkcevfqklkdlkdyggvslpewvcvafhtsgydtqaivqnndsteyglfqinnki
wckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwl
cekl

SCOP Domain Coordinates for d1fkqa_:

Click to download the PDB-style file with coordinates for d1fkqa_.
(The format of our PDB-style files is described here.)

Timeline for d1fkqa_: