SCOPe 2.07: Domain d6jcja1: 6jcj A:1-245

Lineage for d6jcja1 (6jcj A:1-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [278810] (20 PDB entries)

8. Domain d6jcja1: 6jcj A:1-245 [366002]
   Other proteins in same PDB: d6jcja2, d6jcjb2, d6jcjc2, d6jcjd2, d6jcje_, d6jcjf1, d6jcjf2
   automated match to d5fnva1
   complexed with acp, bg0, ca, gdp, gtp, mg

Details for d6jcja1

PDB Entry: 6jcj, 2.5 Å

PDB Description: structure of crolibulin in complex with tubulin

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6jcja1:

Sequence; same for both SEQRES and ATOM records:

>d6jcja1 c.32.1.1 (A:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d6jcja1:

• d6jcja1 is new in SCOPe 2.07-stable
  
• d6jcja1 appears in the current release, SCOPe 2.08