SCOP 1.65: Domain d1hfx__: 1hfx -

Lineage for d1hfx__ (1hfx -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Guinea pig (Cavia porcellus) [TaxId:10141] [53978] (1 PDB entry)

8. Domain d1hfx__: 1hfx - [36600]
   complexed with ca

Details for d1hfx__

PDB Entry: 1hfx, 1.9 Å

PDB Description: alpha-lactalbumin

SCOP Domain Sequences for d1hfx__:

Sequence; same for both SEQRES and ATOM records:

>d1hfx__ d.2.1.2 (-) alpha-Lactalbumin {Guinea pig (Cavia porcellus)}
kqltkcalshelndlagyrditlpewlciifhisgydtqaivknsdhkeyglfqindkdf
cessttvqsrnicdiscdklldddltddimcvkkildikgidywlahkplcsdkleqwyc
eaq

Timeline for d1hfx__:

• d1hfx__ first appeared (with stable ids) in SCOP 1.55
  
• d1hfx__ appears in SCOP 1.63
  
• d1hfx__ appears in SCOP 1.67
  
• d1hfx__ appears in the current release, SCOPe 2.08, called d1hfxa_