Lineage for d6ippa_ (6ipp A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2313377Protein automated matches [190041] (30 species)
    not a true protein
  7. 2313645Species Human (Homo sapiens) [TaxId:9606] [187027] (36 PDB entries)
  8. 3065936Domain d6ippa_: 6ipp A: [365998]
    automated match to d5up8a_
    complexed with fe; mutant

Details for d6ippa_

PDB Entry: 6ipp (more details), 2.7 Å

PDB Description: non-native ferritin 8-mer mutant-c90a/c102a/c130a/d144c
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d6ippa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ippa_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaekl
mklqnqrggriflqdikkpdaddwesglnameaalhleknvnqsllelhklatdkndphl
adfiethylikelgchvtnlrkmgapesglaeylfdkhtlgd

SCOPe Domain Coordinates for d6ippa_:

Click to download the PDB-style file with coordinates for d6ippa_.
(The format of our PDB-style files is described here.)

Timeline for d6ippa_:

  • d6ippa_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-15