SCOPe 2.08: Domain d6ifea2: 6ife A:324-535

Lineage for d6ifea2 (6ife A:324-535)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Bacillus pumilus [TaxId:1408] [353056] (4 PDB entries)

8. Domain d6ifea2: 6ife A:324-535 [365997]
   Other proteins in same PDB: d6ifea1, d6ifeb1
   automated match to d3c2ub2
   complexed with gol

Details for d6ifea2

PDB Entry: 6ife, 1.8 Å

PDB Description: a glycoside hydrolase family 43 beta-xylosidase

PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d6ifea2:

Sequence; same for both SEQRES and ATOM records:

>d6ifea2 b.29.1.0 (A:324-535) automated matches {Bacillus pumilus [TaxId: 1408]}
aptyhtvdefkestlnrhfqtlripftdqigsltekpqhlrlfgresltskftqafvarr
wqsfyfeaetavsffpenfqqaaglvnyyntenwtalqvtydeelgrtlelsvcqnlafs
qplthkiiipdevtyvylkvtvrketykysysfdqkewkeidvpfesihlsddfirgggf
ftgafvgmqcqdtsgerlpadfhyfryeetde

Timeline for d6ifea2:

• d6ifea2 first appeared in SCOPe 2.07