Lineage for d6ifea2 (6ife A:324-535)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 3052994Species Bacillus pumilus [TaxId:1408] [353056] (4 PDB entries)
  8. 3065935Domain d6ifea2: 6ife A:324-535 [365997]
    Other proteins in same PDB: d6ifea1, d6ifeb1
    automated match to d3c2ub2
    complexed with gol

Details for d6ifea2

PDB Entry: 6ife (more details), 1.8 Å

PDB Description: a glycoside hydrolase family 43 beta-xylosidase
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d6ifea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ifea2 b.29.1.0 (A:324-535) automated matches {Bacillus pumilus [TaxId: 1408]}
aptyhtvdefkestlnrhfqtlripftdqigsltekpqhlrlfgresltskftqafvarr
wqsfyfeaetavsffpenfqqaaglvnyyntenwtalqvtydeelgrtlelsvcqnlafs
qplthkiiipdevtyvylkvtvrketykysysfdqkewkeidvpfesihlsddfirgggf
ftgafvgmqcqdtsgerlpadfhyfryeetde

SCOPe Domain Coordinates for d6ifea2:

Click to download the PDB-style file with coordinates for d6ifea2.
(The format of our PDB-style files is described here.)

Timeline for d6ifea2:

  • d6ifea2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6ifea1