SCOPe 2.08: Domain d6ifea1: 6ife A:1-323

Lineage for d6ifea1 (6ife A:1-323)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.0: automated matches [227228] (1 protein)
   not a true family

6. Protein automated matches [226971] (7 species)
   not a true protein

7. Species Bacillus pumilus [TaxId:1408] [353054] (4 PDB entries)

8. Domain d6ifea1: 6ife A:1-323 [365996]
   Other proteins in same PDB: d6ifea2, d6ifeb2
   automated match to d3c2ua1
   complexed with gol

Details for d6ifea1

PDB Entry: 6ife, 1.8 Å

PDB Description: a glycoside hydrolase family 43 beta-xylosidase

PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d6ifea1:

Sequence; same for both SEQRES and ATOM records:

>d6ifea1 b.67.2.0 (A:1-323) automated matches {Bacillus pumilus [TaxId: 1408]}
mkitnpvlkgfnpdpsicrvgedyymavstfewfpgvqiyhskdlvhwrlaarplqktsq
ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtasevdgdwsepil
lnssgfdpslfhdhsgkkyvlnmlwdhrekhhsfagialqeysvaekkligqrkvifkgt
piklteaphlyhigdyyylltaeggtryehaatiarsshiegpyevhpdnpivsafhvpe
hplqkcghasivqthtnewylahltgrpiqsskesifqqrgwcplgretaiqklewkdgw
pyvvggkegtleveapkieekvf

Timeline for d6ifea1:

• d6ifea1 first appeared in SCOPe 2.07