Lineage for d6ifea1 (6ife A:1-323)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397987Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2397997Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2398164Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 2398165Protein automated matches [226971] (7 species)
    not a true protein
  7. 3052992Species Bacillus pumilus [TaxId:1408] [353054] (4 PDB entries)
  8. 3065934Domain d6ifea1: 6ife A:1-323 [365996]
    Other proteins in same PDB: d6ifea2, d6ifeb2
    automated match to d3c2ua1
    complexed with gol

Details for d6ifea1

PDB Entry: 6ife (more details), 1.8 Å

PDB Description: a glycoside hydrolase family 43 beta-xylosidase
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d6ifea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ifea1 b.67.2.0 (A:1-323) automated matches {Bacillus pumilus [TaxId: 1408]}
mkitnpvlkgfnpdpsicrvgedyymavstfewfpgvqiyhskdlvhwrlaarplqktsq
ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtasevdgdwsepil
lnssgfdpslfhdhsgkkyvlnmlwdhrekhhsfagialqeysvaekkligqrkvifkgt
piklteaphlyhigdyyylltaeggtryehaatiarsshiegpyevhpdnpivsafhvpe
hplqkcghasivqthtnewylahltgrpiqsskesifqqrgwcplgretaiqklewkdgw
pyvvggkegtleveapkieekvf

SCOPe Domain Coordinates for d6ifea1:

Click to download the PDB-style file with coordinates for d6ifea1.
(The format of our PDB-style files is described here.)

Timeline for d6ifea1:

  • d6ifea1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6ifea2