Lineage for d6frra_ (6frr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714949Family a.52.1.0: automated matches [254196] (1 protein)
    not a true family
  6. 2714950Protein automated matches [254428] (8 species)
    not a true protein
  7. 2714956Species Artemisia vulgaris [TaxId:4220] [365853] (1 PDB entry)
  8. 2714957Domain d6frra_: 6frr A: [365995]
    automated match to d2alga_
    complexed with so4

Details for d6frra_

PDB Entry: 6frr (more details), 1.95 Å

PDB Description: structural and immunological properties of the allergen art v 3
PDB Compounds: (A:) Non-specific lipid-transfer protein

SCOPe Domain Sequences for d6frra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frra_ a.52.1.0 (A:) automated matches {Artemisia vulgaris [TaxId: 4220]}
mikcsdvsnkisaclsylkqggevpadcctgvkglndaakttpdrqtacnclkttfksnk
dfksdfaaslpskcgvnipykisletdcnkvk

SCOPe Domain Coordinates for d6frra_:

Click to download the PDB-style file with coordinates for d6frra_.
(The format of our PDB-style files is described here.)

Timeline for d6frra_: