![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53977] (3 PDB entries) |
![]() | Domain d1a4v__: 1a4v - [36599] complexed with ca |
PDB Entry: 1a4v (more details), 1.8 Å
SCOP Domain Sequences for d1a4v__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4v__ d.2.1.2 (-) alpha-Lactalbumin {Human (Homo sapiens)} kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc ekl
Timeline for d1a4v__: