Lineage for d6ilta_ (6ilt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904947Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [365917] (3 PDB entries)
  8. 2904952Domain d6ilta_: 6ilt A: [365980]
    automated match to d4xdaa_
    complexed with atp, mg, na

Details for d6ilta_

PDB Entry: 6ilt (more details), 2.2 Å

PDB Description: structure of arabidopsis thaliana ribokinase complexed with atp and magnesium ion
PDB Compounds: (A:) ribokinase

SCOPe Domain Sequences for d6ilta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ilta_ c.72.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mapplvvvgsanadiyveierlpkegetisaktgqtlaggkganqaacgaklmyptyfvg
rlgedahgkliaealgddgcgvhldyvrsvnneptghavvmlqsdgqnsiiivgganmka
wpeimsdddleivrnagivllqreipdsiniqvakavkkagvpvildvggmdtpipnell
dsidilspnetelsrltgmptetfeqisqavakchklgvkqvlvklgskgsalfiqgekp
iqqsiipaaqvvdttgagdtftaafavamvegksheeclrfaaaaaslcvqvkgaipsmp
drksvlkllkfs

SCOPe Domain Coordinates for d6ilta_:

Click to download the PDB-style file with coordinates for d6ilta_.
(The format of our PDB-style files is described here.)

Timeline for d6ilta_: