Lineage for d1hmla_ (1hml A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1397278Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1397279Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 1397307Species Human (Homo sapiens) [TaxId:9606] [53977] (3 PDB entries)
  8. 1397309Domain d1hmla_: 1hml A: [36598]
    complexed with ca, so4, zn

Details for d1hmla_

PDB Entry: 1hml (more details), 1.7 Å

PDB Description: alpha_lactalbumin possesses a distinct zinc binding site
PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1hmla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmla_ d.2.1.2 (A:) alpha-Lactalbumin {Human (Homo sapiens) [TaxId: 9606]}
kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
ekl

SCOPe Domain Coordinates for d1hmla_:

Click to download the PDB-style file with coordinates for d1hmla_.
(The format of our PDB-style files is described here.)

Timeline for d1hmla_: