SCOPe 2.01: Domain d1hmla_: 1hml A:

Lineage for d1hmla_ (1hml A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Human (Homo sapiens) [TaxId:9606] [53977] (3 PDB entries)

8. Domain d1hmla_: 1hml A: [36598]
   complexed with ca, so4, zn

Details for d1hmla_

PDB Entry: 1hml, 1.7 Å

PDB Description: alpha_lactalbumin possesses a distinct zinc binding site

PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1hmla_:

Sequence; same for both SEQRES and ATOM records:

>d1hmla_ d.2.1.2 (A:) alpha-Lactalbumin {Human (Homo sapiens) [TaxId: 9606]}
kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
ekl

Timeline for d1hmla_:

• d1hmla_ first appeared (with stable ids) in SCOP 1.55, called d1hml__
  
• d1hmla_ appears in SCOP 1.75
  
• d1hmla_ appears in SCOPe 2.02
  
• d1hmla_ appears in the current release, SCOPe 2.08