| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
| Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
| Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
| Species Human (Homo sapiens) [TaxId:9606] [53977] (3 PDB entries) |
| Domain d1hml__: 1hml - [36598] complexed with ca, so4, zn |
PDB Entry: 1hml (more details), 1.7 Å
SCOP Domain Sequences for d1hml__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hml__ d.2.1.2 (-) alpha-Lactalbumin {Human (Homo sapiens)}
kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
ekl
Timeline for d1hml__: