SCOP 1.65: Domain d1hml__: 1hml -

Lineage for d1hml__ (1hml -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Human (Homo sapiens) [TaxId:9606] [53977] (3 PDB entries)

8. Domain d1hml__: 1hml - [36598]
   complexed with ca, so4, zn

Details for d1hml__

PDB Entry: 1hml, 1.7 Å

PDB Description: alpha_lactalbumin possesses a distinct zinc binding site

SCOP Domain Sequences for d1hml__:

Sequence; same for both SEQRES and ATOM records:

>d1hml__ d.2.1.2 (-) alpha-Lactalbumin {Human (Homo sapiens)}
kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
ekl

Timeline for d1hml__:

• d1hml__ first appeared (with stable ids) in SCOP 1.55
  
• d1hml__ appears in SCOP 1.63
  
• d1hml__ appears in SCOP 1.67
  
• d1hml__ appears in the current release, SCOPe 2.08, called d1hmla_