Lineage for d1hml__ (1hml -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) 
Protein alpha-Lactalbumin [53975] (5 species) Species Human (Homo sapiens) [TaxId:9606] [53977] (3 PDB entries) 
Domain d1hml__: 1hml - [36598]
Details for d1hml__
PDB Entry: 1hml (more details), 1.7 Å
PDB Description: alpha_lactalbumin possesses a distinct zinc binding site
SCOP Domain Sequences for d1hml__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hml__ d.2.1.2 (-) alpha-Lactalbumin {Human (Homo sapiens)}
kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
ekl
SCOP Domain Coordinates for d1hml__:
Click to download the PDB-style file with coordinates for d1hml__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hml__:
- d1hml__ appears in SCOP 1.57
- d1hml__ appears in the current release, SCOPe 2.08, called d1hmla_
View in 3D