![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
![]() | Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53977] (3 PDB entries) |
![]() | Domain d1b9oa_: 1b9o A: [36597] complexed with ca |
PDB Entry: 1b9o (more details), 1.15 Å
SCOPe Domain Sequences for d1b9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9oa_ d.2.1.2 (A:) alpha-Lactalbumin {Human (Homo sapiens) [TaxId: 9606]} kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivendesteyglfqisnklw ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc ekl
Timeline for d1b9oa_: