Lineage for d1b9oa_ (1b9o A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 850037Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 850038Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 850070Species Human (Homo sapiens) [TaxId:9606] [53977] (3 PDB entries)
  8. 850071Domain d1b9oa_: 1b9o A: [36597]
    complexed with ca

Details for d1b9oa_

PDB Entry: 1b9o (more details), 1.15 Å

PDB Description: human alpha-lactalbumin, low temperature form
PDB Compounds: (A:) protein (alpha-lactalbumin)

SCOP Domain Sequences for d1b9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9oa_ d.2.1.2 (A:) alpha-Lactalbumin {Human (Homo sapiens) [TaxId: 9606]}
kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivendesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
ekl

SCOP Domain Coordinates for d1b9oa_:

Click to download the PDB-style file with coordinates for d1b9oa_.
(The format of our PDB-style files is described here.)

Timeline for d1b9oa_: