Lineage for d6i5cb1 (6i5c B:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445284Species Chicken (Gallus gallus) [TaxId:9031] [278810] (14 PDB entries)
  8. 3065907Domain d6i5cb1: 6i5c B:1-245 [365969]
    Other proteins in same PDB: d6i5ca2, d6i5cb2, d6i5cc2, d6i5cd2, d6i5ce_, d6i5cf1, d6i5cf2, d6i5cf3
    automated match to d5ca1d1
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d6i5cb1

PDB Entry: 6i5c (more details), 2.95 Å

PDB Description: long wavelength native-sad phasing of tubulin-stathmin-ttl complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6i5cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5cb1 c.32.1.1 (B:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d6i5cb1:

Click to download the PDB-style file with coordinates for d6i5cb1.
(The format of our PDB-style files is described here.)

Timeline for d6i5cb1:

  • d6i5cb1 appears in periodic updates to SCOPe 2.07 starting on 2019-03-15