Lineage for d1alca_ (1alc A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. Species Yellow baboon (Papio cynocephalus) [TaxId:9556] [53976] (1 PDB entry)
  8. Domain d1alca_: 1alc A: [36596]
    complexed with ca

Details for d1alca_

PDB Entry: 1alc (more details), 1.7 Å

PDB Description: refined structure of baboon alpha-lactalbumin at 1.7 angstroms resolution. comparison with c-type lysozyme
PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1alca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alca_ d.2.1.2 (A:) alpha-Lactalbumin {Yellow baboon (Papio cynocephalus) [TaxId: 9556]}
kqftkcelsqnlydidgygrialpelictmfhtsgydtqaivendesteyglfqisnalw
ckssqspqsrnicditcdkflddditddimcakkildikgidywiahkalctekleqwlc
ek

SCOPe Domain Coordinates for d1alca_ are not available.

Timeline for d1alca_: