| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
| Family a.137.10.1: Stathmin [101495] (2 proteins) |
| Protein Stathmin 4 [101496] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
| Domain d6i5ce_: 6i5c E: [365957] Other proteins in same PDB: d6i5ca1, d6i5ca2, d6i5cb1, d6i5cb2, d6i5cc1, d6i5cc2, d6i5cd1, d6i5cd2, d6i5cf1, d6i5cf2, d6i5cf3 automated match to d4i4te_ complexed with acp, ca, cl, gdp, gtp, mes, mg |
PDB Entry: 6i5c (more details), 2.95 Å
SCOPe Domain Sequences for d6i5ce_:
Sequence, based on SEQRES records: (download)
>d6i5ce_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke
>d6i5ce_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke
Timeline for d6i5ce_: