Lineage for d6i5ce_ (6i5c E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (99 PDB entries)
  8. 3065895Domain d6i5ce_: 6i5c E: [365957]
    Other proteins in same PDB: d6i5ca1, d6i5ca2, d6i5cb1, d6i5cb2, d6i5cc1, d6i5cc2, d6i5cd1, d6i5cd2, d6i5cf1, d6i5cf2, d6i5cf3
    automated match to d4i4te_
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d6i5ce_

PDB Entry: 6i5c (more details), 2.95 Å

PDB Description: long wavelength native-sad phasing of tubulin-stathmin-ttl complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6i5ce_:

Sequence, based on SEQRES records: (download)

>d6i5ce_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d6i5ce_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

SCOPe Domain Coordinates for d6i5ce_:

Click to download the PDB-style file with coordinates for d6i5ce_.
(The format of our PDB-style files is described here.)

Timeline for d6i5ce_:

  • d6i5ce_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-15